PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462947095
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 1027aa    MW: 116158 Da    PI: 7.3843
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462947095genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox43.45.8e-142072557
               SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
               t+ ++ q++ Le+++ + +yp+ e++ e A+ +gLt +qV++WF+ rR ke++
  462947095 20 TKKSPLQIQMLEKFYTEVQYPKPEDMVEYATTVGLTYSQVRIWFKERRRKERR 72
               566899*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-141376IPR009057Homeodomain-like
PROSITE profilePS5007114.9651373IPR001356Homeobox domain
SMARTSM003893.0E-141577IPR001356Homeobox domain
SuperFamilySSF466892.69E-131777IPR009057Homeodomain-like
CDDcd000863.23E-82063No hitNo description
PfamPF000462.3E-112172IPR001356Homeobox domain
PfamPF156128.9E-6592623IPR028942WHIM1 domain
PfamPF156131.0E-6720759IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1027 aa     Download sequence    Send to blast
MPPAQMMINN LGAKRENAGT KKSPLQIQML EKFYTEVQYP KPEDMVEYAT TVGLTYSQVR  60
IWFKERRRKE RREMETTGAR MERQLSSRSS GPRCSSNASS YNQAPLSESS SISIIGEEHT  120
VRRQGLFHKD YILRKIFRKD GPPLGNEFDP LPQSAHGIIR DATCYDSSLS RRAVNKRKIM  180
EYTDQRSTVP HEDTVPVRKH GIGKGLMTVW HAMYSQSHSV ECQGGSSFID ETGCLRSLRP  240
FDVSDRLEDQ DNGKRIQIKL QSQVMPRKKV DKRSKTPLNK RKVPCRRAIV PKEHSRMDCH  300
LSVDKSELSE RQTELVALVD DEELELSELQ ADLLAKFPPQ SVKMKQPFSM KPWDSSPEML  360
KKLFQVARFV YTHFGNIDVH PFTFDELVQA FHDKVREQEF DVNFWIKSLN SLTWVEILRQ  420
VLVASGFGSK QHMNRDFYDK EKNQMVKYGL RPRTLKGELF ALLSKKGSNG LKVSELAKSP  480
EIVDLNIPGT SELEQLICST LSSDITLFEK IASSAYRLRV DPRIKGKEDT RSDSEECVSV  540
DDEEDACSSD DEPDGSQKIN FPEHERSIVR RKKRKIVHES PNKCCEIDES CPGERWLLGL  600
MEGEYSDLSI DEKLDCLVAL IDVVSGACSV PRLEGPPKVS QNAPKVQPCP SGGKIKKSTK  660
NISLSSDESL NGPGSQGSQG HTVDSRRNDL SGIAHEPQVV LLGSDRRADD PGHRRVYFES  720
SEDGHWEVVD SPQELLSLLS ILDRRGTREA HLLASLEKRQ ACLFEAMKKY LEDGNAVRLA  780
VSSDSCHSET SGDGASPQTS SVDGASPVSE IENTSVPTGH AVSNSDSSSA IVIEIGRSDD  840
EKILIWERLQ AFDKWIWASF YSILTAAKCG KKSFKESLVH CESCHDLYWR DEKHCRICHS  900
TFEVGFDLEE RYAVHVATCR EPEDMSEVPN HKVLPSQLQA LKASIHVIEA SMPEVAFVGS  960
WKKSAHKLWV KRLRRTSSLP ELLQDHTLAS MPEVAFVGSW KKSAHKLWVK RLRRTSSLPE  1020
LLQRWEA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16572RRRKERRE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661208.10.0PREDICTED: uncharacterized protein LOC101768262 isoform X2
TrEMBLK4A5250.0K4A525_SETIT; Uncharacterized protein
STRINGSi033977m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45563350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.11e-110Homeodomain-like transcriptional regulator